Radpuszta : Nyitólap - Rádpuszta élménybirtok

Radpuszta.hu open link

Radpuszta.hu Daily Stats
Daily Unique Visitors   Daily Unique Visitors 2
Daily Pageviews   Daily Pageviews 7
Daily  Revenue   Daily Revenue $ 0.02
Radpuszta.hu Monthly Stats
Estimated Monthly Stats   Monthly Unique Visitors 72
Monthly Pageviews   Monthly Pageviews 207
Monthly  Revenue   Monthly Revenue $ 0.62
Radpuszta.hu Yearly Stats
Yearly Unique Visitors   Yearly Unique Visitors 889
Yearly Pageviews   Yearly Pageviews 2,557
yearly  Revenue   Yearly Revenue $ 7.67

Radpuszta.hu or simply erothots receives roughly 7 pageviews (page impressions) daily from it's 2 unique daily visitor. The creation date of radpuszta.hu was not found. and it's hosted on the IP Address 178.238.222.79 in Budapest, Hungary. It has an estimated worth of $ 25.00 and a global Alexa rank of 3,518,513.

Updated 2 months ago

Update Now!

Radpuszta.hu Basic information

Domain name Radpuszta.hu
Title

Nyitólap - Rádpuszta élménybirtok

Keywords

Description

ÉLMÉNYEKKEL TELI KIKAPCSOLÓDÁS VÁR RÁD Üdvözlünk Rádpusztán Tradicionális csárda, magyar borok, lenyűgöző rendezvényház és egyedülálló lovas programok a Balaton közelében – hogy élmény legyen a kikapcsolódás. FEDEZD FEL SZOLGÁLTATÁSAINKAT HAGYOMÁNYOK MODERN KÖNTÖSBEN Magyar Borok Pincéje Hagyomány és modernitás, letűnt évszázadok, faragott hordók, interaktív elemek és impozáns belsőépítészeti megoldások – a Magyar Borok Pincéje 2014 óta

Radpuszta.hu Location Stats

IP Address 178.238.222.79
Country Hungary Hungary
Region Budapest
City Budapest
Longitude 19.0555
Latitude 47.518

Radpuszta.hu Header

  Radpuszta.hu DNS Records

  Radpuszta.hu SSL Certificate

  Radpuszta.hu WHOIS

% Whois server 4.0 serving the hu ccTLD


domain: radpuszta.hu
record created: 2004-02-19
Tovabbi adatokert ld.:
https://www.domain.hu/domain-kereses/
For further data see:
https://www.domain.hu/domain-search/

  Typos of Radpuszta.hu

www.adpuszta.huwww.rqdpuszta.hu
www.rdpuszta.huwww.rzdpuszta.hu
www.rapuszta.huwww.raspuszta.hu
www.raduszta.huwww.raepuszta.hu
www.radpszta.huwww.rarpuszta.hu
www.radpuzta.huwww.rafpuszta.hu
www.radpusta.huwww.racpuszta.hu
www.radpusza.huwww.raxpuszta.hu
www.radpuszt.huwww.radouszta.hu
www.rradpuszta.huwww.radluszta.hu
www.raadpuszta.huwww.radpyszta.hu
www.raddpuszta.huwww.radphszta.hu
www.radppuszta.huwww.radpjszta.hu
www.radpuuszta.huwww.radpiszta.hu
www.radpusszta.huwww.radpuazta.hu
www.radpuszzta.huwww.radpuwzta.hu
www.radpusztta.huwww.radpuezta.hu
www.radpusztaa.huwww.radpudzta.hu
www.ardpuszta.huwww.radpuxzta.hu
www.rdapuszta.huwww.radpuzzta.hu
www.rapduszta.huwww.radpusata.hu
www.radupszta.huwww.radpussta.hu
www.radpsuzta.huwww.radpusxta.hu
www.radpuzsta.huwww.radpuszra.hu
www.radpustza.huwww.radpuszfa.hu
www.radpuszat.huwww.radpuszga.hu
www.eadpuszta.huwww.radpuszya.hu
www.dadpuszta.huwww.radpuszts.hu
www.fadpuszta.huwww.radpusztq.hu
www.tadpuszta.huwww.radpusztz.hu
www.rsdpuszta.hu

Recently Viewed Websites

WebsiteLast Visit
thecmtc.com1 Sec ago
pinnacleweb.com4 Sec ago
gesundheit-nord.at7 Sec ago
diogoalbrecht.com.br7 Sec ago
srikanchimahaswamividyamandir.org7 Sec ago